PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G429300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 319aa    MW: 35255.1 Da    PI: 4.9444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G429300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-192269148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd+llv++v+ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sevir.9G429300.1.p 22 RGPWTVEEDLLLVNYVASHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 69
                        89********************************************97 PP

2Myb_DNA-binding51.91.7e-1675118146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sevir.9G429300.1.p  75 RGNITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.0321773IPR017930Myb domain
SuperFamilySSF466893.2E-3120116IPR009057Homeodomain-like
SMARTSM007177.5E-162171IPR001005SANT/Myb domain
PfamPF002491.3E-172269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-232376IPR009057Homeodomain-like
CDDcd001675.29E-122469No hitNo description
PROSITE profilePS5129418.87374124IPR017930Myb domain
SMARTSM007176.2E-1574122IPR001005SANT/Myb domain
PfamPF002492.1E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2377123IPR009057Homeodomain-like
CDDcd001675.49E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDMAHERDAS SEEEVMAGEL RRGPWTVEED LLLVNYVASH GEGRWNSLAR SAGLKRTGKS  60
CRLRWLNYLR PDLRRGNITP QEQLLILELH SRWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKHAKQLKCD VNSQQFKDVM RYLWMPRLVE RIQAAAAAGA PQPQTGTADT PLSSSWQHGA  180
DDGLYASPGD ACWPAEYYSA AGDHQLLNNP AVPELSSTTA GSSSPSSDSG AGAQTWLAPV  240
GEAEWFTTAC DASSAAVAMH DTVLAGHQQQ QQPCLLGETW TSSELPELGV ADFEIGSFDV  300
ESIWSMDDNL WYTQTQGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251312218126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387360.0BT038736.1 Zea mays full-length cDNA clone ZM_BFb0316K16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984581.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLK4AA160.0K4AA16_SETIT; Uncharacterized protein
STRINGSi035722m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-83myb domain protein 112